Products

Activin B, Mouse

Activins and inhibins, members of the TGF-beta superfamily, are disulfide-linked dimeric proteins that were originally purified from gonadal fluids as proteins that stimulated or inhibited, respectively, pituitary follicle stimulating hormone (FSH) release. Activin is strongly expressed in wounded skin, and overexpression of activin in epidermis of transgenic mice improves wound healing and enhances scar formation. Activin also regulates the morphogenesis of branching organs such as the prostate, lung, and kidney. There is also evidence showed that lack of activin during development results in neural developmental defects.
No. Size Price Qty Status
C02067-5UG 5 ug $108.00 Inquiry
C02067-20UG 20 ug $268.00 Inquiry
C02067-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSM
LYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus

UnitProt ID:
Q04999
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <1 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for Activin B, Mouse

Average Rating: 0 (0 Reviews )